PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G03260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family DBB
Protein Properties Length: 328aa    MW: 34817.5 Da    PI: 5.3224
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G03260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.8e-07447542
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                      C+ ++  e++  C  ++  lC  C +e H        H++vpl
  LPERR06G03260.1  4 QCNACGAAEARVLCCADEAALCTACDEEVHAAnklagkHQRVPL 47
                     7******99*********************66899999999986 PP

2zf-B_box30.19.7e-106496335
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      +kC+ ++e    +fC +++ llC+dC +++H 
  LPERR06G03260.1 64 VPKCDICQEASGYFFCLEDRALLCRDCDVSIHT 96
                     689*****************************3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.722147IPR000315B-box-type zinc finger
CDDcd000211.46E-8347No hitNo description
PfamPF006432.3E-5447IPR000315B-box-type zinc finger
SMARTSM003363.0E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501198.80262109IPR000315B-box-type zinc finger
SMARTSM003365.7E-1662109IPR000315B-box-type zinc finger
PfamPF006431.5E-76496IPR000315B-box-type zinc finger
CDDcd000212.13E-966109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MKIQCNACGA AEARVLCCAD EAALCTACDE EVHAANKLAG KHQRVPLLSD GVAPSAAAAA  60
ASAVPKCDIC QEASGYFFCL EDRALLCRDC DVSIHTVNSF VSVHQRFLLT GVQVGLDPAD  120
PVPPIADKHV NTTGASVDSP TKHLQRNPTV LLSGESSASL TSQNATNRDH SRQNSVTIAR  180
NGAVNWTMGN NTIRSIDPPP KYSTEESPAL LLAGHTNTMA AYSNQISKDS DQVYNLPFAG  240
GNGSDSLHDW PVDDFFSNSE FGFAEHGSTK GDNGKQGSAE GSPQCSLAEG LFAEGLLGQV  300
PDNPWTVPEN SQNNFTVSAG LKRRRRQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018860.0AB001886.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:R2931.
GenBankAK0722310.0AK072231.1 Oryza sativa Japonica Group cDNA clone:J023001E21, full insert sequence.
GenBankAK1040830.0AK104083.1 Oryza sativa Japonica Group cDNA clone:001-029-D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644333.10.0PREDICTED: B-box zinc finger protein 22
TrEMBLA0A0D9WM060.0A0A0D9WM06_9ORYZ; Uncharacterized protein
STRINGORGLA06G0034600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17943382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.19e-55light-regulated zinc finger protein 1